Analytical Data
-
Gene name
ZC3HC1
- Application
-
Alternative Names
hNIPA; NIPA_HUMAN; Nuclear interacting partner of ALK; Nuclear interacting partner of anaplastic lymphoma kinase; Nuclear-interacting partner of ALK; Nuclear-interacting partner of anaplastic lymphoma kinase; zc3hc1; Zinc finger C3HC type containing 1; Zinc finger C3HC-type Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86WB0
-
Expression Region
1-51 aa
-
AA Sequence
MRGLPRKREAWTRRTRLPHPSQLMDHPKRNNLHWNLQAKKPSLAEWKHFLL
-
Molecular Weight
31.35 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZC3HC1, also known as Zinc Finger C3HC4-Type Containing 1, is a protein that plays a crucial role in various cellular processes, including the regulation of gene expression, cell proliferation, and differentiation. Its unique structure, characterized by a specific type of zinc finger motif, enables it to interact with multiple proteins, influencing diverse signaling pathways. Research into ZC3HC1 has gained momentum due to its potential implications in human health and disease, particularly in the context of cancer and genetic disorders. Studies have shown that ZC3HC1 can modulate immune responses and cellular stress, making it a key player in maintaining cellular homeostasis. Furthermore, aberrations in ZC3HC1 expression or function have been linked to the development of tumors and autoimmune diseases, underscoring the importance of understanding its mechanistic role in these conditions. The recombinant expression of ZC3HC1 allows for detailed analyses of its functions, protein interactions, and potential therapeutic applications. As such, the characterization of ZC3HC1 at the molecular level is vital for unraveling its contributions to cellular dynamics and could lead to novel strategies for intervention in diseases associated with its dysregulation.
