Analytical Data
-
Gene name
EFCAB1
- Application
-
Alternative Names
EF-hand calcium binding domain 1; EF-hand calcium-binding domain-containing protein 1; EFCAB1; EFCB1_HUMAN
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9HAE3
-
Expression Region
1-211aa
-
AA Sequence
MNRKKLQKLTDTLTKNCKHFNKFEVNCLIKLFYDLVGGVERQGLVVGLDRNAFRNILHVTFGMTDDMIMDRVFRGFDKDNDGCVNVLEWIHGLSLFLRGSLEEKMKYCFEVFDLNGDGFISKEEMFHMLKNSLLKQPSEEDPDEGIKDLVEITLKKMDHDHDGKLSFADYELAVREETLLLEAFGPCLPDPKSQMEFEAQVFKDPNEFNDM
-
Molecular Weight
50.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EFCAB1 (EF-hand calcium-binding protein 1) is a member of the EF-hand calcium-binding protein family, which plays a crucial role in cellular calcium signaling and various physiological processes. Its involvement in calcium homeostasis makes it an important candidate for understanding calcium-related diseases and cellular mechanisms. Research into EFCAB1 has gained momentum due to its potential implications in neuromodulation and muscle contraction. Studies suggest that EFCAB1 may influence synaptic transmission and neuronal excitability, highlighting its relevance in neurodegenerative disorders. Additionally, aberrant EFCAB1 expression has been linked to cardiac and skeletal muscle pathologies, emphasizing the need for a deeper elucidation of its functional roles and molecular mechanisms. As a recombinant protein, EFCAB1 can be produced in vitro, enabling researchers to investigate its biochemical properties, interaction with ligands, and potential as a therapeutic target. The recombinant form also facilitates high-throughput screening for small molecule modulators, providing valuable insights into the modulation of calcium signaling pathways. The ongoing research aims to dissect the precise functions of EFCAB1 in various tissues, with the goal of developing novel strategies for therapeutic intervention in calcium-related pathologies.
