Analytical Data
-
Gene name
TEGT
- Application
-
Alternative Names
TMBIM6; BI1; TEGT; Bax inhibitor 1; BI-1; Testis-enhanced gene transcript Protein; Transmembrane BAX inhibitor motif-containing Protein 6
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P55061
-
Expression Region
1-237 aa
-
AA Sequence
MNIFDRKINFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLSALGSLILMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALEFCIAVNPSILPTAFMGTAMIFTCFTLSALYARRRSYLFLGGILMSALSLLLLSSLGNVFFGSIWLFQANLYVGLVVMCGFVLFDTQLIIEKAEHGDQDYIWHCIDLFLDFITVFRKLMMILAMNEKDKKKEKK
-
Molecular Weight
52.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TEGT (testis-specific enhanced gene transcription factor) is a member of the ETS family of transcription factors, which play crucial roles in various biological processes, including development, differentiation, and tumorigenesis. The study of TEGT is particularly important due to its testis-specific expression, making it a potential marker for male germ cell development and function. Research has indicated that TEGT is involved in regulating genes essential for spermatogenesis, thus contributing to male fertility. Its unique expression pattern also enhances its appeal as a candidate for targeted therapies in male infertility issues and certain types of cancer associated with the reproductive system. Understanding the molecular mechanisms underlying TEGT's function can provide insights into its role in gene regulation and its potential as a therapeutic target. Advances in recombinant protein technology have enabled the production and purification of TEGT, facilitating detailed studies of its structure and function. This research is crucial for elucidating the pathways governed by TEGT and its interaction with other factors in the ETS family, ultimately paving the way for innovative approaches to treat reproductive disorders and malignancies involving TEGT dysregulation.
