Recombinant Human MUL1 Protein，N-His

MUL1

SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

0610009K11Rik; AV000801; C1orf166; Chromosome 1 open reading frame 166; E3 SUMO-protein ligase MUL1; E3 ubiquitin ligase; E3 ubiquitin protein ligase MUL1; E3 ubiquitin-protein ligase MUL1; FLJ12875; GIDE; Growth inhibition and death E3 ligase; MAPL; Mitochondrial anchored protein ligase; mitochondrial E3 ubiquitin ligase 1; mitochondrial E3 ubiquitin protein ligase 1; Mitochondrial ubiquitin ligase activator of NFKB 1

Human

E. coli

N-His

Greater than 90% as determined by SDS-PAGE.

Q969V5

30-238aa

RQKARVSQELKGAKKVHLGEDLKSILSEAPGKCVPYAVIEGAVRSVKETLNSQFVENCKGVIQRLTLQEHKMVWNRTTHLWNDCSKIIHQRTNTVPFDLVPHEDGVDVAVRVLKPLDSVDLGLETVYEKFHPSIQSFTDVIGHYISGERPKGIQETEEMLKVGATLTGVGELVLDNNSVRLQPPKQGMQYYLSSQDFDSLLQRQESSVR

24.5 kDa

< 1.0 EU per μg protein as determined by the LAL method.

Freeze-dried powder

PBS, pH7.4, 5% Trehalose

Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.