Analytical Data
-
Gene name
TEBP
- Application
-
Alternative Names
Co chaperone p23; cPGES; Cytosolic prostaglandin E synthase; Cytosolic prostaglandin E2 synthase; Hsp90 co chaperone; Hsp90 co-chaperone; P23; Progesterone receptor complex; Progesterone receptor complex p23; Prostaglandin E synthase 3 (cytosolic); Prostaglandin E synthase 3; PTGES 3; PTGES3; Sid 3177; TEBP; TEBP_HUMAN; Telomerase binding Protein p23; Telomerase-binding Protein p23; Unactive progesterone receptor 23 kD
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15185
-
Expression Region
1-160 aa
-
AA Sequence
MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE
-
Molecular Weight
24.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TEBP (Telomere Binding Protein) is a crucial protein that plays a significant role in maintaining telomere integrity and regulating telomere length. The study of TEBP has gained momentum due to its essential functions in cellular aging, genome stability, and the onset of age-related diseases, including cancer. Telomeres, the protective caps at the ends of chromosomes, prevent degradation and subsequent DNA damage, thus ensuring proper chromosomal replication. Disruption in TEBP function or dysregulation of telomere maintenance can lead to telomere shortening, which is associated with cellular senescence and contributes to various pathologies. Research has focused on understanding the molecular mechanisms by which TEBP interacts with telomeric DNA and other associated proteins, providing insights into its role in telomere dynamics and cell proliferation. Moreover, given the pivotal role of telomeres in cancer biology, TEBP has emerged as a potential target for therapeutic intervention. By exploring the structural and functional characteristics of TEBP, scientists aim to develop strategies that could enhance telomere stability and potentially prevent or treat diseases linked to telomere dysfunction. Overall, investigating TEBP and its pathway is critical for understanding fundamental biological processes and developing novel approaches in regenerative medicine and oncology.
