Analytical Data
-
Gene name
LAT1
- Application
-
Alternative Names
LAT1;CD98LC;LAT1;MPE16;Large neutral amino acids transporter small subunit 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43561-2
-
Expression Region
28-233aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMHCHRLPGSYDSTSSDSLYPRGIQFKRPHT VAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANS VASYENEEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTP GIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTE PAALSSQEAEEVEEEGAPDYENLQELN
-
Molecular Weight
24 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LAT1 (L-type amino acid transporter 1) is a member of the SLC7 family of solute carriers, primarily responsible for the transport of large neutral amino acids across the plasma membrane. Its role is particularly crucial in various physiological processes, including neurotransmitter synthesis, cellular metabolism, and immune response. LAT1 is highly expressed in many tissues, especially in the brain and in rapidly proliferating cells, such as cancer cells, where it facilitates the uptake of essential amino acids that are vital for cell growth and survival. The dysregulation of LAT1 expression has been implicated in various pathological conditions, including tumors, neurodegenerative diseases, and metabolic disorders. Consequently, LAT1 has emerged as a potential therapeutic target for cancer treatment and metabolic regulation. Research efforts have focused on understanding its structural characteristics, substrate specificity, and transport mechanisms, as well as identifying inhibitors that could modulate its activity effectively. Recent advances in recombinant protein technology have enabled the production of functional LAT1, providing a valuable tool for detailed biochemical and pharmacological studies. Investigating LAT1 at the molecular level could pave the way for novel therapeutic approaches aimed at tackling diseases associated with its dysfunction. Overall, the study of LAT1 and its recombinant protein form holds significant promise for both basic research and clinical applications, highlighting its importance in the fields of biochemistry and medical science.











