Cat: PA1000-8159

Recombinant Human LAT1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    LAT1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    LAT1;CD98LC;LAT1;MPE16;Large neutral amino acids transporter small subunit 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O43561-2

  • Expression Region

    28-233aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMHCHRLPGSYDSTSSDSLYPRGIQFKRPHT VAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANS VASYENEEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTP GIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTE PAALSSQEAEEVEEEGAPDYENLQELN

  • Molecular Weight

    24 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

LAT1 (L-type amino acid transporter 1) is a member of the SLC7 family of solute carriers, primarily responsible for the transport of large neutral amino acids across the plasma membrane. Its role is particularly crucial in various physiological processes, including neurotransmitter synthesis, cellular metabolism, and immune response. LAT1 is highly expressed in many tissues, especially in the brain and in rapidly proliferating cells, such as cancer cells, where it facilitates the uptake of essential amino acids that are vital for cell growth and survival. The dysregulation of LAT1 expression has been implicated in various pathological conditions, including tumors, neurodegenerative diseases, and metabolic disorders. Consequently, LAT1 has emerged as a potential therapeutic target for cancer treatment and metabolic regulation. Research efforts have focused on understanding its structural characteristics, substrate specificity, and transport mechanisms, as well as identifying inhibitors that could modulate its activity effectively. Recent advances in recombinant protein technology have enabled the production of functional LAT1, providing a valuable tool for detailed biochemical and pharmacological studies. Investigating LAT1 at the molecular level could pave the way for novel therapeutic approaches aimed at tackling diseases associated with its dysfunction. Overall, the study of LAT1 and its recombinant protein form holds significant promise for both basic research and clinical applications, highlighting its importance in the fields of biochemistry and medical science.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US