Analytical Data
-
Gene name
GRM1
- Application
-
Alternative Names
GRM1；GPRC1A；MGLUR1；Metabotropic glutamate receptor 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13255
-
Expression Region
387-486aa
-
AA Sequence
NPNFKRICTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGHVGLCDAMKPIDGSKLLDFLIKSSFIGVSGEEVWFDEKGDAPGRYDIMNLQY
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GRM1, or glutamate receptor metabotropic 1, is a member of the metabotropic glutamate receptor family and plays a crucial role in neurotransmission and synaptic plasticity in the central nervous system. Aberrant GRM1 signaling has been implicated in various neurological disorders, including epilepsy, schizophrenia, and certain forms of cancer. The study of GRM1 recombinant proteins is significant for several reasons. Firstly, understanding the structure and function of GRM1 can provide insights into its role in neuronal signaling pathways and its contribution to neurophysiological processes. Additionally, the design and characterization of GRM1 recombinant proteins facilitate the development of targeted therapeutics that may modulate its activity in pathological conditions. By utilizing techniques such as protein expression in heterologous systems and functional assays, researchers aim to elucidate the pharmacological properties and interaction mechanisms of GRM1 with other cellular components. This information is essential for identifying potential drug candidates and understanding their therapeutic implications. Overall, the ongoing research on GRM1 recombinant proteins not only enhances our knowledge of glutamatergic signaling but also holds promise for developing innovative treatments for neuropsychiatric and neurodegenerative diseases.
