Analytical Data
-
Gene name
CCKAR
- Application
-
Alternative Names
CCKAR；CCKRA；Cholecystokinin receptor type A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P32238
-
Expression Region
1-428aa
-
AA Sequence
MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ
-
Molecular Weight
47.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Identification
Protein Description
CCKAR (cholecystokinin A receptor) is a G protein-coupled receptor that mediates the physiological effects of cholecystokinin (CCK), a hormone involved in digestion and appetite regulation. Research on CCKAR has gained significant attention due to its potential implications in metabolic disorders, obesity, and gastrointestinal diseases. CCKAR plays a crucial role in pancreatic enzyme secretion, gallbladder contraction, and the modulation of satiety signaling in the brain. Understanding the structure and function of CCKAR is essential for developing selective agonists or antagonists that could serve as therapeutic agents for conditions like obesity and pancreatitis. Additionally, the exploration of CCKAR's signaling pathways and its interactions with other receptors could reveal novel insights into its role in neuroendocrine regulation and its broader impact on human health. The recombinant expression of CCKAR in various systems provides valuable tools for biochemical characterization and drug discovery, enhancing our understanding of its physiological functions and offering new avenues for treatment strategies targeting metabolic and gastrointestinal diseases. Through structural biology techniques, researchers aim to elucidate the receptor's conformational changes and ligand-binding mechanisms, paving the way for innovative therapeutic developments.
