Analytical Data
-
Gene name
TAS2R47
- Application
-
Alternative Names
TAS2R30; TAS2R47; Taste receptor type 2 member 30; T2R30; Taste receptor type 2 member 47; T2R47
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P59541
-
Expression Region
1-319 aa
-
AA Sequence
MITFLPIIFSILIVVIFVIGNFANGFIALVNSIEWVKRQKISFVDQILTALAVSRVGLLWVLLLHWYATQLNPAFYSVEVRITAYNVWAVTNHFSSWLATSLSMFYLLRIANFSNLIFLRIKRRVKSVVLVILLGPLLFLVCHLFVINMDETVWTKEYEGNVTWKIKLRSAMYHSNMTLTMLANFVPLTLTLISFLLLICSLCKHLKKMQLHGKGSQDPSTKVHIKALQTVTSFLLLCAIYFLSMIISVCNFGRLEKQPVFMFCQAIIFSYPSTHPFILILGNKKLKQIFLSVLRHVRYWVKDRSLRLHRFTRGALCVF
-
Molecular Weight
61.49 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TAS2R47 is a member of the TAS2R family of bitter taste receptors, which play a crucial role in the perception of bitter compounds in humans and other mammals. These receptors are pivotal for detecting potentially harmful substances and have been associated with various physiological processes and behaviors related to taste and eating. The study of TAS2R47, in particular, has garnered interest due to its unique ligand recognition properties and its potential implications in understanding individual differences in taste perception and dietary preferences. This receptor exhibits distinct expression patterns in different tissues and appears to be involved not only in taste but also in broader physiological functions, including gastrointestinal signaling and metabolic responses. As obesity and related metabolic disorders have become major public health issues, investigating the role of TAS2R47 and its signaling pathways may provide insights into novel strategies for dietary interventions and therapeutic approaches. Research involving the recombinant form of TAS2R47 allows for detailed characterization of its interactions with ligands, elucidation of its signaling mechanisms, and exploration of its potential as a target for modulating taste perception and influencing food choices. Understanding the structure-function relationship of TAS2R47 could further enhance our knowledge of taste receptor biology and its impact on health, leading to advancements in taste-related research and applications in nutrition science. Overall, the study of TAS2R47 represents a fascinating intersection of taste perception research, genetic diversity, and metabolic health, highlighting its importance in both basic and applied science.
