Analytical Data
-
Gene name
LAMb3
- Application
-
Alternative Names
LAMb3;LAMNB1;Laminin subunit beta-3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13751
-
Expression Region
1064-1171aa
-
AA Sequence
AEGASEQALSAQEGFERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAE ELFGETMEMMDRMKDMELELLRGSQAIMLRSADLTGLEKRVEQIRDHING RVLYYATC
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LAMb3, also known as laminin beta-3, is a key component of the extracellular matrix that plays a crucial role in tissue remodeling, cell adhesion, and signaling. It is part of the laminin family of proteins, which are essential for the structural integrity of basement membranes. Research into LAMb3 recombinant protein is driven by its potential implications in various medical fields, including regenerative medicine, cancer biology, and tissue engineering. Given its critical functions in cell-matrix interactions, LAMb3 has been studied for its role in developmental processes, wound healing, and the tumor microenvironment. Understanding the properties and interactions of LAMb3 can aid in the design of biomaterials that promote tissue regeneration and repair. Furthermore, its involvement in pathological conditions, such as cancer metastasis, makes it a potential target for therapeutic interventions. The recombinant production of LAMb3 allows researchers to investigate its biological functions in detail, develop assays for drug screening, and explore its utility in clinical applications, highlighting the significance of LAMb3 in both fundamental and applied biomedical research.











