Analytical Data
-
Gene name
TAF4
- Application
-
Alternative Names
TAF4; TAF2C; TAF2C1; TAF4A; TAFII130; TAFII135; Transcription initiation factor TFIID subunit 4; RNA polymerase II TBP-associated factor subunit C; TBP-associated factor 4; Transcription initiation factor TFIID 130 kDa subunit; TAF(II)130; TAFII-130; TAFII130; Transcription initiation factor TFIID 135 kDa subunit; TAF(II)135; TAFII-135; TAFII135
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00268
-
Expression Region
1-335 aa
-
AA Sequence
MATFVSELEAAKKNLSEALGDNVKQYWANLKLWFKQKISKEEFDLEAHRLLTQDNVHSHNDFLLAILTRCQILVSTPDGAGSLPWPGGSAAKPGKPKGKKKLSSVRQKFDHRFQPQNPLSGAQQFVAKDPQDDDDLKLCSHTMMLPTRGQLEGRMIVTAYEHGLDNVTEEAVSAVVYAVENHLKDILTSVVSRRKAYRLRDGHFKYAFGSNVTPQPYLKNSVVAYNNLIESPPAFTAPCAGQNPASHPPPDDAEQQAALLLACSGDTLPASLPPVNMYDLFEALQVHREVIPTHTVYALNIERIITKLWHPNHEELQQDKVHRQRLAAKEGLLLC
-
Molecular Weight
63.8kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TAF4, or TATA-binding protein-associated factor 4, is a crucial component of the transcription factor IID (TFIID) complex, playing a pivotal role in the regulation of gene expression. The importance of TAF4 arises from its involvement in the initiation of transcription by RNA polymerase II, where it facilitates the binding of the TATA-binding protein (TBP) to the promoter regions of genes. Recent studies have highlighted TAF4's significance in various biological processes, including cellular differentiation, development, and response to stress. Dysregulation of TAF4 has been associated with several diseases, including cancer, making it an attractive target for therapeutic intervention. Researchers have focused on developing recombinant TAF4 proteins to study its functional properties, interactions with other transcription factors, and its role in different signaling pathways. The use of recombinant protein technology allows for the production of TAF4 in sufficient quantities for biochemical assays and structural studies. This research is crucial for understanding how TAF4 contributes to gene regulation and its potential implications in disease mechanisms, paving the way for the development of targeted therapies that can modulate TAF4 activity in pathological conditions. As a result, the study of recombinant TAF4 proteins continues to be an area of active investigation within molecular biology and therapeutic development.
