Analytical Data
-
Gene name
TAF1L
- Application
-
Alternative Names
TAF1L; Transcription initiation factor TFIID subunit 1-like; TAF(II)210; TBP-associated factor 1-like; TBP-associated factor 210 kDa; Transcription initiation factor TFIID 210 kDa subunit
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IZX4
-
Expression Region
1532 -1641 aa
-
AA Sequence
NIVTQKMMAVPDSWPFHHPVNKKFVPDYYKMIVNPVDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNICYQTITEYDEHLTQLEKDICTAK
-
Molecular Weight
37.84kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TAF1L (TATA-box binding protein associated factor 1-like) is a protein that plays a critical role in the regulation of gene expression and has been implicated in various cellular processes, including transcriptional regulation and chromatin remodeling. Research into TAF1L has gained momentum due to its potential involvement in several diseases, particularly cancer, where alterations in gene expression can lead to malignant transformations. The gene encoding TAF1L has been shown to interact with various transcription factors and components of the transcription machinery, suggesting its importance in modulating gene activity. Additionally, studies have indicated that TAF1L may participate in DNA damage repair and cellular stress responses, highlighting its multifaceted role in cellular homeostasis. The recombination and production of TAF1L as a recombinant protein facilitate in vitro studies, enabling researchers to dissect its functional domains and elucidate the mechanisms underlying its involvement in transcriptional regulation. Characterizing TAF1L at the molecular level could contribute to the development of novel therapeutic strategies targeting dysregulated gene expression in diseases. Overall, the study of TAF1L recombinant protein represents a significant avenue for understanding the complex regulatory networks in the cell and offers insights into its potential as a biomarker or therapeutic target in pathological contexts.
