Analytical Data
-
Gene name
SYNGR2
- Application
-
Alternative Names
Cellugyrin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43760
-
Expression Region
168-224 aa
-
AA Sequence
QRYKAGVDDFIQNYVDPTPDPNTAYASYPGASVDNYQQPPFTQNAETTEGYQPPPVY
-
Molecular Weight
7.9kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SYNGR2 (synaptogyrin-2) is a member of the synaptogyrin family, which plays a crucial role in synaptic function and neurotransmitter release. It is predominantly expressed in the brain, particularly in regions associated with cognitive processes. Recent studies have indicated that SYNGR2 is involved in various neurobiological mechanisms, including synaptic plasticity and neuronal communication, making it a significant candidate for understanding the molecular underpinnings of neurodevelopmental and psychiatric disorders. Research on recombinant SYNGR2 protein aims to elucidate its structure-function relationships, interactions with other synaptic proteins, and regulatory pathways in neurons. The study of SYNGR2 is particularly relevant in the context of disorders such as schizophrenia and autism spectrum disorders, where synaptic dysfunction is often implicated. By characterizing SYNGR2 through recombinant protein techniques, researchers hope to uncover potential therapeutic targets and biomarkers for these conditions, ultimately contributing to better understanding and treatment options for neurodevelopmental disorders. This focus on SYNGR2 underscores the importance of synaptic proteins in maintaining neuronal health and function.
