Analytical Data
-
Gene name
CYSLTR2
- Application
-
Alternative Names
CYSLTR2；CYSLT2；CYSLT2R；Cysteinyl leukotriene receptor 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NS75
-
Expression Region
1-346aa
-
AA Sequence
MERKFMSLQPSISVSEMEPNGTFSNNNSRNCTIENFKREFFPIVYLIIFFWGVLGNGLSIYVFLQPYKKSTSVNVFMLNLAISDLLFISTLPFRADYYLRGSNWIFGDLACRIMSYSLYVNMYSSIYFLTVLSVVRFLAMVHPFRLLHVTSIRSAWILCGIIWILIMASSIMLLDSGSEQNGSVTSCLELNLYKIAKLQTMNYIALVVGCLLPFFTLSICYLLIIRVLLKVEVPESGLRVSHRKALTTIIITLIIFFLCFLPYHTLRTVHLTTWKVGLCKDRLHKALVITLALAAANACFNPLLYYFAGENFKDRLKSALRKGHPQKAKTKCVFPVSVWLRKETRV
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CYSLTR2, or cysteinyl leukotriene receptor 2, is a G-protein-coupled receptor involved in various physiological processes, particularly in the modulation of inflammatory responses and bronchoconstriction. It plays a critical role in the pathophysiology of asthma, allergic reactions, and other respiratory conditions. Research on the recombinant protein of CYSLTR2 has gained traction due to its potential implications in drug development and therapeutic intervention. By studying this receptor, scientists aim to elucidate its signaling pathways, understand its interactions with ligands like leukotrienes, and explore its structural characteristics through recombinant expression. The production of CYSLTR2 recombinant proteins enables high-throughput screening of potential antagonists, paving the way for novel treatments targeting inflammatory diseases. Furthermore, understanding the receptor's structure-function relationship can aid in the design of more selective and effective drugs, ultimately improving patient outcomes in diseases associated with dysregulated leukotriene signaling. As such, the investigation of CYSLTR2 recombinant proteins presents a promising avenue for optimizing therapies aimed at managing chronic inflammatory conditions.
