Analytical Data
-
Gene name
SYNE1
- Application
-
Alternative Names
8B; ARCA1; C6orf98; CPG2; CPG2 full length; dJ45H2.2; EDMD4; Enaptin; Myne-1; MYNE1; Myocyte nuclear envelope protein 1; Nesp1; Nesprin 1; Nesprin-1; Nuclear envelope spectrin repeat protein 1; SCAR8; Spectrin repeat containing nuclear envelope 1; Synaptic nuclear envelope protein 1; Synaptic nuclei expressed gene 1; Syne-1; SYNE1; SYNE1_HUMAN; SYNE1B
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NF91
-
Expression Region
1561-1670 aa
-
AA Sequence
LRKIQQSVSEFEDKLAVPIKICSSATETYKVLQEHMDLCQALESLSSAITAFSASARKVVNRDSCVQEAAALQQQYEDILRRAKERQTALENLLAHWQRLEKELSSFLTW
-
Molecular Weight
37.84kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SYNE1, also known as synemin 1, is a protein that plays a critical role in the structural integrity of the cytoskeleton and cell membrane interactions. Mutations in the SYNE1 gene have been linked to various myopathies and neurological disorders, highlighting its importance in muscle function and neuronal integrity. Research on SYNE1 recombinant proteins has gained traction in recent years as scientists aim to elucidate its specific functions and interactions within cellular contexts. The study of SYNE1 through recombinant protein technology allows for the production of large quantities of the protein in a controlled environment, facilitating detailed biochemical and biophysical analyses. Understanding the mechanism of action of SYNE1 at the molecular level could lead to advancements in therapeutic approaches for congenital muscular dystrophies and other related disorders. By exploring its protein structure, interaction partners, and functional pathways, researchers hope to uncover potential targets for drug development and regenerative medicine strategies. Overall, the investigation of SYNE1 recombinant proteins is crucial for developing a comprehensive understanding of its physiological roles and implications in disease.
