Cat: PAX2000-11776

Recombinant Human SYNE1 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SYNE1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    8B; ARCA1; C6orf98; CPG2; CPG2 full length; dJ45H2.2; EDMD4; Enaptin; Myne-1; MYNE1; Myocyte nuclear envelope protein 1; Nesp1; Nesprin 1; Nesprin-1; Nuclear envelope spectrin repeat protein 1; SCAR8; Spectrin repeat containing nuclear envelope 1; Synaptic nuclear envelope protein 1; Synaptic nuclei expressed gene 1; Syne-1; SYNE1; SYNE1_HUMAN; SYNE1B

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8NF91

  • Expression Region

    1561-1670 aa

  • AA Sequence

    LRKIQQSVSEFEDKLAVPIKICSSATETYKVLQEHMDLCQALESLSSAITAFSASARKVVNRDSCVQEAAALQQQYEDILRRAKERQTALENLLAHWQRLEKELSSFLTW

  • Molecular Weight

    37.84kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SYNE1, also known as synemin 1, is a protein that plays a critical role in the structural integrity of the cytoskeleton and cell membrane interactions. Mutations in the SYNE1 gene have been linked to various myopathies and neurological disorders, highlighting its importance in muscle function and neuronal integrity. Research on SYNE1 recombinant proteins has gained traction in recent years as scientists aim to elucidate its specific functions and interactions within cellular contexts. The study of SYNE1 through recombinant protein technology allows for the production of large quantities of the protein in a controlled environment, facilitating detailed biochemical and biophysical analyses. Understanding the mechanism of action of SYNE1 at the molecular level could lead to advancements in therapeutic approaches for congenital muscular dystrophies and other related disorders. By exploring its protein structure, interaction partners, and functional pathways, researchers hope to uncover potential targets for drug development and regenerative medicine strategies. Overall, the investigation of SYNE1 recombinant proteins is crucial for developing a comprehensive understanding of its physiological roles and implications in disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US