Analytical Data
-
Gene name
WBSCR27
- Application
-
Alternative Names
Williams-Beuren syndrome chromosomal region 27 Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N6F8
-
Expression Region
1-245 aa
-
AA Sequence
MAQEEGGSLPEVRARVRAAHGIPDLAQKLHFYDRWAPDYDQDVATLLYRAPRLAVDCLTQALPGPPHSALILDVACGTGLVAAELRAPGFLQLHGVDGSPGMLEQAQAPGLYQRLSLCTLGQEPLPSPEGTFDAVLIVGALSDGQVPCNAIPELHVTKPGGLVCLTTRTNSSNLQYKEALEATLDRLEQAGMWEGLVAWPVDRLWTAGSWLPPSWRWYPASLPRMASSPALSTCTESGRRPRLRK
-
Molecular Weight
33.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
WBSCR27 is a protein associated with Williams-Beuren syndrome (WBS), a genetic disorder caused by a deletion of genetic material on chromosome 7. This syndrome is characterized by cardiovascular issues, distinctive facial features, and cognitive impairments. The study of WBSCR27 focuses on its role in the molecular mechanisms underlying WBS, as well as its potential functions in cellular processes such as development and neurobiology. Given that WBSCR27 is thought to be involved in the regulation of gene expression and cellular signaling, researchers aim to elucidate its structure-function relationship through recombinant protein studies. By producing WBSCR27 as a recombinant protein, scientists can analyze its biochemical properties, interactions with other proteins, and its impact on cellular pathways. This research not only deepens our understanding of WBS but may also provide insights into therapeutic strategies for managing the associated symptoms of the syndrome. Exploring WBSCR27 may reveal crucial information about the genetic and molecular underpinnings of the disorder, ultimately contributing to advancements in targeted therapies and improved outcomes for affected individuals.
