Analytical Data
-
Gene name
SUCNR1
- Application
-
Alternative Names
G-protein coupled receptor 91;P2Y purinoceptor 1-like
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BXA5
-
Expression Region
1-334 aa
-
AA Sequence
MLGIMAWNATCKNWLAAEAALEKYYLSIFYGIEFVVGVLGNTIVVYGYIFSLKNWNSSNIYLFNLSVSDLAFLCTLPMLIRSYANGNWIYGDVLCISNRYVLHANLYTSILFLTFISIDRYLIIKYPFREHLLQKKEFAILISLAIWVLVTLELLPILPLINPVITDNGTTCNDFASSGDPNYNLIYSMCLTLLGFLIPLFVMCFFYYKIALFLKQRNRQVATALPLEKPLNLVIMAVVIFSVLFTPYHVMRNVRIASRLGSWKQYQCTQVVINSFYIVTRPLAFLNSVINPVFYFLLGDHFRDMLMNQLRHNFKSLTSFSRWAHELLLSFREK
-
Molecular Weight
40.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The SUCNR1 gene encodes a receptor known as the succinate receptor 1, which plays a crucial role in various physiological processes, including the regulation of metabolism and inflammation. Research has indicated that SUCNR1 is involved in sensing metabolic changes in the body, particularly in response to succinate, a key intermediate in the tricarboxylic acid cycle. Abnormal SUCNR1 signaling has been implicated in several pathological conditions, including cardiovascular diseases, cancer, and metabolic disorders. Consequently, the study of SUCNR1 recombinant proteins has gained significant attention as a potential therapeutic target. Recombinant SUCNR1 proteins allow for the investigation of receptor function, ligand interaction, and downstream signaling pathways in controlled experimental settings. Understanding the structure and dynamics of SUCNR1 via recombinant technologies can provide insights into its role in disease mechanisms and may aid in the development of novel therapeutic approaches that modulate its activity. Furthermore, the production of SUCNR1 proteins in heterologous systems facilitates high-throughput screening of small molecules that could serve as SUCNR1 modulators, aiming to uncover new treatment strategies for various conditions associated with dysregulated succinate signaling. Overall, the research on SUCNR1 recombinant proteins is vital for unraveling the complexities of succinate signaling in health and disease, paving the way for innovative biomedical applications.
