Analytical Data
-
Gene name
DNCL2A
- Application
-
Alternative Names
DYNLRB1; BITH; DNCL2A; DNLC2A; ROBLD1; HSPC162Dynein light chain roadblock-type 1; Bithoraxoid-like protein; BLP; Dynein light chain 2A
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NP97
-
Expression Region
22-96aa
-
AA Sequence
VVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE
-
Molecular Weight
33.99 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DNCL2A, a member of the DNase I-like family, has garnered attention in recent years due to its potential role in cellular processes such as apoptosis, inflammation, and immune response modulation. The protein is characterized by its enzymatic activity, specifically its ability to cleave nucleic acids, which positions it as a critical player in DNA repair and cellular homeostasis. Research has indicated that DNCL2A may be involved in the development of various diseases, including autoimmune disorders and cancers, highlighting its significance in biomedical research. The recombinant expression of DNCL2A offers a valuable tool for studying its functional properties and mechanisms of action in vitro. By generating sufficient quantities of the protein through recombinant technologies, researchers can conduct detailed biochemical assays, structural analyses, and functional studies. This can lead to a better understanding of DNCL2A's role within the cellular context and its potential as a therapeutic target. Overall, the exploration of DNCL2A as a recombinant protein represents a promising avenue for advancing our knowledge of its biological functions and implications in health and disease.
