Analytical Data
-
Gene name
SUCLG1
- Application
-
Alternative Names
FLJ21114; FLJ43513; GALPHA; MTDPS9; SCS alpha; SCS-alpha; SUCA_HUMAN; Succinate CoA ligase alpha subunit ; Succinyl CoA ligase [GDP forming] subunit alpha mitochondrial; Succinyl CoA synthetase subunit alpha; Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha; mitochondrial; Succinyl-CoA synthetase subunit alpha; SUCLA1; SUCLG 1; SUCLG1
-
Species
Human
-
Source
E. coli
-
Tag
N-terminal His-Tag
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P53597
-
Expression Region
42-346 aa
-
AA Sequence
SYTASRQHLYVDKNTKIICQGFTGKQGTFHSQQALEYGTKLVGGTTPGKGGQTH LGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIEAEIPLVVCITEGIPQ QDMVRVKHKLLRQEKTRLIGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRSG TLTYEAVHQTTQVGLGQSLCVGIGGDPFNGTDFIDCLEIFLNDSATEGIILIGE IGGNAEENAAEFLKQHNSGPNSKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGA KEKISALQSAGVVVSMSPAQLGTTIYKEFEKRKML
-
Molecular Weight
35.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Identification
Protein Description
SUCLG1 (succinate-CoA ligase, GDP-forming, alpha subunit) is a crucial enzyme involved in the citric acid cycle and plays a vital role in metabolic processes, particularly in energy production and biosynthesis in various organisms. Understanding SUCLG1's function is essential for elucidating the metabolic pathways it influences and the implications of its dysregulation in various diseases, including cancer and metabolic disorders. Research has shown that mutations in the SUCLG1 gene can lead to severe neurological conditions, emphasizing its importance in mitochondrial function and energy metabolism. Previous studies have demonstrated that SUCLG1 is important for the optimal functioning of the citric acid cycle, providing insights into how it contributes to ATP production and overall cellular health. The recombinant expression of SUCLG1 protein allows for in-depth investigations into its structure and function, facilitating the study of its enzyme kinetics and interaction with other metabolic components. This knowledge has significant implications for developing therapeutic strategies targeting metabolic diseases. Therefore, the study of SUCLG1 recombinant protein is not just pivotal for understanding its own metabolic role but also for exploring potential disease mechanisms linked to metabolic dysfunction. Expanding our knowledge of SUCLG1 could lead to new avenues for treatment and intervention in diseases characterized by mitochondrial and metabolic abnormalities.
