Analytical Data
-
Gene name
PYY
- Application
-
Alternative Names
PYY;Peptide YY
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P10082
-
Expression Region
1-97aa
-
AA Sequence
MVFVRRPWPALTTVLLALLVCLGALVDAYPIKPEAPGEDASPEELNRYYA SLRHYLNLVTRQRYGKRDGPDRLLSKTFFPDGEDRPVRSRSEGPDLW
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Peptide YY (PYY) is a gastrointestinal hormone primarily secreted by the L-cells in the intestines in response to food intake. It plays a crucial role in regulating appetite, food intake, and energy balance by inhibiting gastric motility and promoting a feeling of fullness. Due to its physiological significance, the recombinant production of PYY has garnered interest in both basic research and therapeutic applications. The molecular understanding of PYY's structure and function has opened avenues for exploring its potential in treating obesity and metabolic disorders. Researchers have focused on developing recombinant PYY to study its biological effects more comprehensively and to design analogs that might enhance its effectiveness as a weight-loss drug. By utilizing advanced genetic engineering and protein expression techniques, scientists aim to generate biologically active forms of PYY that can be used in preclinical and clinical studies. Additionally, understanding the mechanisms of PYY signaling could lead to novel strategies for modulating appetite and energy expenditure, offering potential benefits for individuals struggling with weight management. Moreover, recombinant PYY could serve as a valuable tool for dissecting the complex interplay between gut hormones and brain signals related to hunger and satiety, thereby enhancing our knowledge of the intricate regulatory networks governing body weight. As obesity rates continue to rise globally, the exploration of PYY and its recombinant forms remains a critical area of research with promising implications for developing effective interventions in metabolic health.











