Cat: PA1000-8004

Recombinant Human PYY Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PYY

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PYY;Peptide YY

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P10082

  • Expression Region

    1-97aa

  • AA Sequence

    MVFVRRPWPALTTVLLALLVCLGALVDAYPIKPEAPGEDASPEELNRYYA SLRHYLNLVTRQRYGKRDGPDRLLSKTFFPDGEDRPVRSRSEGPDLW

  • Molecular Weight

    37 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Peptide YY (PYY) is a gastrointestinal hormone primarily secreted by the L-cells in the intestines in response to food intake. It plays a crucial role in regulating appetite, food intake, and energy balance by inhibiting gastric motility and promoting a feeling of fullness. Due to its physiological significance, the recombinant production of PYY has garnered interest in both basic research and therapeutic applications. The molecular understanding of PYY's structure and function has opened avenues for exploring its potential in treating obesity and metabolic disorders. Researchers have focused on developing recombinant PYY to study its biological effects more comprehensively and to design analogs that might enhance its effectiveness as a weight-loss drug. By utilizing advanced genetic engineering and protein expression techniques, scientists aim to generate biologically active forms of PYY that can be used in preclinical and clinical studies. Additionally, understanding the mechanisms of PYY signaling could lead to novel strategies for modulating appetite and energy expenditure, offering potential benefits for individuals struggling with weight management. Moreover, recombinant PYY could serve as a valuable tool for dissecting the complex interplay between gut hormones and brain signals related to hunger and satiety, thereby enhancing our knowledge of the intricate regulatory networks governing body weight. As obesity rates continue to rise globally, the exploration of PYY and its recombinant forms remains a critical area of research with promising implications for developing effective interventions in metabolic health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US