Analytical Data
-
Gene name
DNCH1
- Application
-
Alternative Names
DYNC1H1; DHC1; DNCH1; DNCL; DNECL; DYHC; KIAA0325Cytoplasmic dynein 1 heavy chain 1; Cytoplasmic dynein heavy chain 1; Dynein heavy chain; cytosolic
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q14204
-
Expression Region
1-197aa
-
AA Sequence
MISKMLKMQMLEDEDDLAYAETEKKTRTDSTSDGRPAWMRTLHTTASNWLHLIPQTLSHLKRTVENIKDPLFRFFEREVKMGAKLLQDVRQDLADVVQVCEGKKKQTNYLRTLINELVKGILPRSWSHYTVPAGMTVIQWVSDFSERIKQLQNISLAAASGGAKELKVKALLTSLGWSAAVLGWGGSGSGEKHRAQV
-
Molecular Weight
48.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DNCH1, a member of the dynamin-like GTPase family, has gained significant attention in recent years due to its critical role in cellular processes such as mitochondrial dynamics, cell migration, and membrane trafficking. Research has highlighted its involvement in various diseases, including neurodegenerative disorders and cancers, where altered expression or function of DNCH1 may contribute to pathogenesis. The recombinant protein production of DNCH1 allows for detailed biochemical and biophysical studies, facilitating the understanding of its mechanism of action at the molecular level. By expressing and purifying DNCH1 in vitro, researchers can explore its GTPase activity, oligomerization, and interactions with other cellular proteins. Characterizing the structural and functional properties of DNCH1 is essential to uncover its biological roles and potential therapeutic targets. Furthermore, understanding how DNCH1 interacts with its substrates can provide insights into its involvement in pathological processes, paving the way for designing innovative strategies to modulate its function in diseases. Hence, the study of DNCH1 recombinant protein not only enhances our fundamental knowledge of cellular biology but also holds promise for advancing therapeutic interventions.











