Cat: PA2000-7186

Recombinant Human DNCH1 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DNCH1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DYNC1H1; DHC1; DNCH1; DNCL; DNECL; DYHC; KIAA0325Cytoplasmic dynein 1 heavy chain 1; Cytoplasmic dynein heavy chain 1; Dynein heavy chain; cytosolic

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q14204

  • Expression Region

    1-197aa

  • AA Sequence

    MISKMLKMQMLEDEDDLAYAETEKKTRTDSTSDGRPAWMRTLHTTASNWLHLIPQTLSHLKRTVENIKDPLFRFFEREVKMGAKLLQDVRQDLADVVQVCEGKKKQTNYLRTLINELVKGILPRSWSHYTVPAGMTVIQWVSDFSERIKQLQNISLAAASGGAKELKVKALLTSLGWSAAVLGWGGSGSGEKHRAQV

  • Molecular Weight

    48.6 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DNCH1, a member of the dynamin-like GTPase family, has gained significant attention in recent years due to its critical role in cellular processes such as mitochondrial dynamics, cell migration, and membrane trafficking. Research has highlighted its involvement in various diseases, including neurodegenerative disorders and cancers, where altered expression or function of DNCH1 may contribute to pathogenesis. The recombinant protein production of DNCH1 allows for detailed biochemical and biophysical studies, facilitating the understanding of its mechanism of action at the molecular level. By expressing and purifying DNCH1 in vitro, researchers can explore its GTPase activity, oligomerization, and interactions with other cellular proteins. Characterizing the structural and functional properties of DNCH1 is essential to uncover its biological roles and potential therapeutic targets. Furthermore, understanding how DNCH1 interacts with its substrates can provide insights into its involvement in pathological processes, paving the way for designing innovative strategies to modulate its function in diseases. Hence, the study of DNCH1 recombinant protein not only enhances our fundamental knowledge of cellular biology but also holds promise for advancing therapeutic interventions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US