Analytical Data
-
Gene name
DLX6
- Application
-
Alternative Names
Distal less homeo box 6 ; Distal less homeobox 6; Distal less homeobox gene 6a ; DLX6; DLX6_HUMAN; Homeobox protein DLX-6; MGC125282; MGC125283; MGC125284; MGC125285; OTTHUMP00000205294
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P56179
-
Expression Region
1-175aa
-
AA Sequence
MSHSQHSPYLQSYHNSSAAAQTRGDDTDQQKTTVIENGEIRFNGKGKKIRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLLKQGSNPHESDPLQGSAALSPRSPALPPVWDVSASAKGVSMPPNSYMPGYSHWYSSPHQDTMQRPQMM
-
Molecular Weight
46.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DLX6 is a member of the Distal-Less (DLX) gene family, which plays a critical role in vertebrate development, particularly in the formation of the brain and craniofacial structures. Its importance is underscored by its involvement in various developmental processes and its potential implications in neurodevelopmental disorders. Abnormalities in DLX6 expression have been linked to conditions such as schizophrenia and other neuropsychiatric disorders, making it a target of interest for understanding the molecular mechanisms underlying these diseases. Research on DLX6 recombinant protein has focused on elucidating its structure-function relationship and interactions with other molecules during neural differentiation and development. Additionally, recombinant DLX6 protein is utilized in various experimental models to study its role in gene regulation and signaling pathways. The production and characterization of this protein help clarify its biological functions and potential therapeutic applications, thereby contributing significantly to developmental biology and medicine.
