Analytical Data
-
Gene name
DLX4
- Application
-
Alternative Names
Beta protein 1; BP1; Distal less homeo box 7; Distal less homeo box 9; distal-less homeobox 4; DLX4; DLX4_HUMAN; DLX7; DLX8; DLX9; Homeobox protein DLX-4
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q92988
-
Expression Region
1-240aa
-
AA Sequence
MTSLPCPLPGRDASKAVFPDLAPVPSVAAAYPLGLSPTTAASPNLSYSRPYGHLLSYPYTEPANPGDSYLSCQQPAALSQPLCGPAEHPQELEADSEKPRLSPEPSERRPQAPAKKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQNSGGQEGDFPGRTFSVSPCSPPLPSLWDLPKAGTLPTSGYGNSFGAWYQHHSSDVLASPQMM
-
Molecular Weight
52.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DLX4, a member of the Distal-less homeobox gene family, plays a critical role in development and differentiation processes, particularly in the formation of the nervous system and various tissues. Research has shown that DLX4 is involved in the regulation of key signaling pathways and cellular mechanisms, influencing neurogenesis and potentially affecting the development of several neurological disorders. Studies have identified its significant expression in embryonic stem cells and its role in maintaining pluripotency and self-renewal capabilities. The recombinant protein of DLX4 has emerged as an important tool in understanding its functional mechanisms, providing insights into gene regulatory networks. Furthermore, the implications of DLX4 in tumorigenesis, where it may play contrasting roles in different cancer types, have garnered attention. Investigating the properties and interactions of DLX4 recombinant protein can lead to advancements in therapeutic strategies targeting developmental and oncological conditions. Researchers are focusing on the protein's structure-function relationship and its potential applications in regenerative medicine and gene therapy, aiming to harness its regulatory capabilities for developing novel treatments. Overall, the study of DLX4 recombinant protein serves as a promising avenue for enhancing our understanding of developmental biology and its associated pathological conditions.
