Analytical Data
-
Gene name
DLX5
- Application
-
Alternative Names
DLX5Homeobox protein DLX-5
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P56178
-
Expression Region
1-289aa
-
AA Sequence
MTGVFDRRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHGYCSPTSASYGKALNPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNRVPSATNQPEKEVTEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQHPLALASGTLY
-
Molecular Weight
57.53 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DLX5 is a member of the distal-less homeobox (DLX) gene family, which plays a crucial role in embryonic development and the regulation of various biological processes. It is primarily involved in the development of the face and the forebrain, contributing to the formation of craniofacial structures and neuronal differentiation. Abnormalities in DLX5 expression have been linked to various developmental disorders, including isolated cleft lip and palate, which highlights its significance in craniofacial biology. Additionally, DLX5 has been implicated in the regulation of osteogenic differentiation, making it a point of interest in bone development research and potential therapeutic applications for bone-related diseases. The study of recombinant DLX5 protein provides insights into its functional properties and mechanisms of action, enabling researchers to investigate its interactions with other molecular players involved in developmental pathways. By expressing and purifying the DLX5 protein in a recombinant system, researchers aim to dissect its structure-function relationship, explore its binding affinities, and evaluate its downstream effects on gene expression. This research not only enhances our understanding of DLX5's role in normal development but also holds promise for identifying therapeutic targets in congenital disorders and regenerative medicine. The development of methods for robust recombinant DLX5 production is vital for advancing the field and facilitating further studies on its biological implications. Overall, the research surrounding DLX5 recombinant protein is a crucial step towards elucidating its function in development, disease, and potential therapeutic interventions.
