Analytical Data
-
Gene name
TLR9
- Application
-
Alternative Names
TLR9；Toll-like receptor 9
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NR96
-
Expression Region
99-215aa
-
AA Sequence
PPVGLSPMHFPCHMTIEPSTFLAVPTLEELNLSYNNIMTVPALPKSLISL SLSHTNILMLDSASLAGLHALRFLFMDGNCYYKNPCRQALEVAPGALLGL GNLTHLSLKYNNLTVVP
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Toll-like receptor 9 (TLR9) is a member of the Toll-like receptor family, which plays a crucial role in the innate immune system by recognizing pathogen-associated molecular patterns, particularly unmethylated CpG DNA found in bacterial and viral genomes. Research on TLR9 has gained prominence due to its potential therapeutic applications in vaccine development, autoimmune diseases, and cancer immunotherapy. The activation of TLR9 induces a robust immune response, promoting the maturation of dendritic cells and the subsequent activation of T and B lymphocytes, which are essential for generating adaptive immune responses. Additionally, TLR9 is also implicated in the pathogenesis of various diseases, as its dysregulation can lead to inappropriate immune responses. Consequently, the study of recombinant TLR9 proteins aims to elucidate their structural and functional properties, enhancing our understanding of TLR9 signaling pathways and their impact on immune modulation. These insights could pave the way for innovative therapeutic strategies that harness the power of TLR9 to enhance vaccine efficacy or regulate autoimmune conditions, making it a significant focus in immunology research.
