Analytical Data
-
Gene name
DDX28
- Application
-
Alternative Names
DDX 28; DDX28; DDX28_HUMAN; DEAD (Asp Glu Ala Asp) box polypeptide 28; DEAD box polypeptide 28; DEAD/H (Asp Glu Ala Asp/His) box polypeptide 28
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NUL7
-
Expression Region
1-540aa
-
AA Sequence
MALARPVRLFSLVTRLLLAPRRGLTVRSPDEPLPVVRIPVALQRQLEQRQSRRRNLPRPVLVRPGPLLVSARRPELNQPARLTLGRWERAPLASQGWKSRRARRDHFSIERAQQEAPAVRKLSSKGSFADLGLEPRVLHALQEAAPEVVQPTTVQSSTIPSLLRGRHVVCAAETGSGKTLSYLLPLLQRLLGQPSLDSLPIPAPRGLVLVPSRELAQQVRAVAQPLGRSLGLLVRDLEGGHGMRRIRLQLSRQPSADVLVATPGALWKALKSRLISLEQLSFLVLDEADTLLDESFLELVDYILEKSHIAEGPADLEDPFNPKAQLVLVGATFPEGVGQLLNKVASPDAVTTITSSKLHCIMPHVKQTFLRLKGADKVAELVHILKHRDRAERTGPSGTVLVFCNSSSTVNWLGYILDDHKIQHLRLQGQMPALMRVGIFQSFQKSSRDILLCTDIASRGLDSTGVELVVNYDFPPTLQDYIHRAGRVGRVGSEVPGTVISFVTHPWDVSLVQKIELAARRRRSLPGLASSVKEPLPQAT
-
Molecular Weight
86 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DDX28 is a member of the DEAD-box RNA helicase family, known for its vital role in RNA metabolism, including RNA unwinding, splicing, and translation. This protein has garnered research interest due to its potential involvement in various cellular processes and diseases, including cancer. Alterations in the expression or function of DDX28 have been linked to disrupted RNA homeostasis, which can lead to pathophysiological conditions. Furthermore, its significance in mitochondrial function and translational regulation makes it a critical target for understanding mitochondrial disorders and related pathologies. Recent studies have explored the biochemical properties of DDX28, including its RNA-binding affinity and helicase activity. Furthermore, recombinant DDX28 proteins have been produced for functional assays to elucidate its roles in normal and disease contexts. By investigating the molecular mechanisms through which DDX28 operates, researchers aim to uncover potential therapeutic targets and diagnostic markers for diseases associated with its dysregulation. Overall, the study of DDX28 and its recombinant form is imperative for advancing our understanding of RNA biology and the implications of RNA helicases in health and disease.
