Cat: PA1000-7821

Recombinant Human LIMS1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    LIMS1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    LIMS1;PINCH;PINCH1;LIM and senescent cell antigen-like-containing domain Protein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P48059

  • Expression Region

    1-325aa

  • AA Sequence

    MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLF YEFEGRKYCEHDFQMLFAPCCHQCGEFIIGRVIKAMNNSWHPECFRCDLC QEVLADIGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIDEQPLIFK NDPYHPDHFNCANCGKELTADARELKGELYCLPCHDKMGVPICGACRRPI EGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLAYCETHYNQLFGD VCFHCNRVIEGDVVSALNKAWCVNCFACSTCNTKLTLKNKFVEFDMKPVC KKCYEKFPLELKKRLKKLAETLGRK

  • Molecular Weight

    62 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

LIMS1 (LIM domain-containing scaffolding protein 1) is a crucial element in cellular signaling and organization, notably associated with various cellular functions including cytoskeletal dynamics, cell adhesion, and signal transduction. Its role in modulating the behavior of different cell types has garnered attention in the field of molecular biology and biochemistry. The study of recombinant LIMS1 protein has emerged due to its potential implications in understanding cell development and differentiation processes as well as its involvement in various diseases, including cardiovascular and neurological disorders. The recombinant expression of LIMS1 allows for detailed biophysical and biochemical characterization, enabling researchers to dissect its functional properties and interactions with other cellular proteins. Furthermore, the elucidation of its structure-function relationship aids in deciphering the molecular mechanisms underlying its role in cellular pathways. Research into LIMS1 also holds promise for the development of novel therapeutic strategies, as targeting its interactions could provide new avenues for treating conditions associated with dysregulated signaling pathways. Overall, the exploration of LIMS1 recombinant protein unveils critical insights into its biological significance and therapeutic potential.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US