Analytical Data
-
Gene name
ZMAT5
- Application
-
Alternative Names
ZMAT5；Zinc finger matrin-type Protein 5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UDW3
-
Expression Region
1-170aa
-
AA Sequence
MGKRYFCDYCDRSFQDNLHNRKKHLNGLQHLKAKKVWYDMFRDAAAILLDEQNKRPCRKFLLTGQCDFGSNCRFSHMSERDLQELSIQVEEERRAREWLLDAPELPEGHLEDWLEKRAKRLSSAPSSRAEPIRTTVFQYPVGWPPVQELPPSLRAPPPGGWPLQPRVQWG
-
Molecular Weight
36.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZMAT5, also known as zinc finger matrin-type protein 5, is a member of the zinc-finger protein family that plays crucial roles in various biological processes, including gene regulation, cellular differentiation, and apoptosis. Recent studies have highlighted its involvement in critical cellular functions and potential associations with diseases such as cancer. Research has indicated that ZMAT5 acts as a transcriptional regulator, influencing the expression of genes essential for cell growth and survival. Its expression levels have been shown to vary in different tissues and under various physiological conditions, suggesting a role in cellular responses to environmental stimuli. Additionally, the aberrant expression of ZMAT5 has been linked to tumor progression, making it a candidate for further investigation in cancer research. The recombinant expression of ZMAT5 is pivotal for studying its structure-function relationships and developing potential therapeutic applications. Producing ZMAT5 as a recombinant protein allows for the analysis of its biochemical properties and interactions with other cellular molecules. By understanding the functional mechanisms of ZMAT5, researchers aim to unravel its role in cellular pathways and its potential as a biomarker or therapeutic target in various diseases. Thus, the study of ZMAT5 recombinant protein holds significant promise for advancing our understanding of its biological functions and implications in health and disease.
