Analytical Data
-
Gene name
DDX26
- Application
-
Alternative Names
DBI 1; DBI-1; DBI1; DDX26; DDX26A; DEAD box protein; DEAD/H (Asp Glu Ala Asp/His) box polypeptide 26; Deleted in cancer 1; DICE1; DKFZp434B105; HDB; Int6; INT6_HUMAN; Integrator complex subunit 6; INTS 6; ints6; Notchl2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UL03
-
Expression Region
779-887aa
-
AA Sequence
DKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQIMKEIRKPGRKYERIFTLLKHVQGSLQTRLIFLQNVIKEASRFKKRMLIEQLENFLDEIHRRANQINHINSN
-
Molecular Weight
37.73 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DDX26 is a member of the DEAD-box helicase family, which plays crucial roles in various aspects of RNA metabolism, including RNA unwinding, splicing, and translation regulation. Research into DDX26 has gained traction due to its potential implications in cellular homeostasis and disease mechanisms, particularly in cancer and neurological disorders. The protein is known to interact with multiple RNA-binding proteins and has been implicated in the regulation of gene expression at the post-transcriptional level. Given its critical functions, understanding the structure and activity of DDX26 is essential for elucidating its role in normal cellular processes and disease pathology. Recent studies have focused on characterizing DDX26 as a recombinant protein to facilitate detailed biochemical and biophysical analyses, enabling researchers to dissect its functional mechanisms. The availability of purified DDX26 allows for in vitro studies to explore its interactions with RNA and other molecular partners, providing insights into how dysregulation of DDX26 may contribute to disease states. Overall, the investigation of DDX26 as a recombinant protein stands to advance our comprehension of RNA biology and its implications in health and disease.
