Analytical Data
-
Gene name
SLC25A48
- Application
-
Alternative Names
SLC25A48; Solute carrier family 25 member 48
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6ZT89
-
Expression Region
1-157 aa
-
AA Sequence
MGSFQLEDFAAGWIGGAASVIVGHPLDTVKTRLQAGVGYGNTLSCIRVVYRRESMFGFFKGMSFPLASIAVYNSVVFGVFSNTQRFLSQHRCGEPEASPPRTLSDLLLASMVAGVVSVGLGGPVDLIKIRLQMQTQPFRDGGEHRMTTVFPGPHLCM
-
Molecular Weight
43.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The SLC25A48 gene encodes a member of the solute carrier family 25, which is involved in mitochondrial transport processes. This family of proteins plays a crucial role in cellular metabolism by facilitating the transport of metabolites and ions across the mitochondrial membrane, thereby influencing energy production and various metabolic pathways. Recent studies have highlighted the significance of SLC25A48 in maintaining mitochondrial function and its potential implications in metabolic disorders. Given the increasing prevalence of such disorders, understanding the structure and function of SLC25A48 is critical. The recombinant protein of SLC25A48 presents an invaluable tool for elucidating its biochemical properties, interactions, and transport mechanisms. By producing and studying this recombinant protein, researchers can gain insights into its role in cellular energy homeostasis and its potential involvement in diseases such as obesity and diabetes. Additionally, this research may open new avenues for therapeutic interventions targeting the dysregulation of mitochondrial transport processes, leading to the development of novel treatment strategies. Overall, the study of SLC25A48 recombinant protein represents a promising frontier in mitochondrial research, with far-reaching implications for understanding metabolism and developing targeted therapies for metabolic diseases.
