Analytical Data
-
Gene name
BAS1
- Application
-
Alternative Names
BAS1；2-Cys peroxiredoxin BAS1. chloroplastic
-
Species
Mouse
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96291
-
Expression Region
66-266aa
-
AA Sequence
KAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHSEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYIQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI
-
Molecular Weight
24.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BAS1, a gene encoding a branch chain aminotransferase, plays a crucial role in plant metabolism by regulating the synthesis of branched-chain amino acids (BCAAs) such as leucine, isoleucine, and valine. These amino acids are essential not only for protein synthesis but also for various metabolic processes, including energy production and stress response. The study of BAS1 recombinant proteins has gained traction in the field of plant biotechnology and metabolic engineering, as manipulating its expression can enhance stress tolerance, improve yield, and alter nutritional profiles in crops. Additionally, BAS1 has drawn interest due to its potential applications in synthetic biology, where engineered pathways can optimize BCAA production for use in pharmaceuticals, food, and feed industries. Research in this area often involves the cloning of the BAS1 gene, expression in suitable host systems, and subsequent characterization of the recombinant protein's enzymatic activity and physiological effects on plant growth and development. Understanding the molecular mechanisms underlying BAS1 function can provide valuable insights into plant resilience under abiotic stresses and contribute to sustainable agricultural practices in the face of climate change and food security challenges.
