Analytical Data
-
Gene name
B7H4
- Application
-
Alternative Names
B7H4；B7H4；V-set domain-containing T-cell activation inhibitor 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7Z7D3
-
Expression Region
26-258aa
-
AA Sequence
IIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKA
-
Molecular Weight
52.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of B7-H4, a member of the B7 family of immune regulatory molecules, has gained significant attention in recent years due to its pivotal role in modulating immune responses and its implications in cancer immunotherapy. B7-H4 is primarily expressed on tumor cells and certain immune cells, where it functions as a negative regulator of T cell activation. This immune checkpoint molecule inhibits T cell proliferation and cytokine production by engaging receptors on T cells, leading to the suppression of anti-tumor immunity. Understanding the mechanisms governing B7-H4 expression and its interactions with immune cells is crucial for developing innovative therapeutic strategies aimed at enhancing anti-tumor responses. Additionally, elevated levels of B7-H4 have been associated with poor prognosis in various cancers, highlighting its potential as a biomarker for disease progression and treatment outcomes. Current research is focused on elucidating the signaling pathways involved in B7-H4 regulation, exploring its biological functions in the tumor microenvironment, and investigating its potential as a therapeutic target in combination with other immune checkpoint inhibitors. As the landscape of cancer treatment evolves, B7-H4 emerges as a promising candidate for advancing personalized immunotherapies and improving the efficacy of existing treatments.
