Analytical Data
-
Gene name
SLC1A4
- Application
-
Alternative Names
Alanine/serine/cysteine/threonine transporter 1; ASCT-1; ASCT1; AW045657; Glutamate/neutral amino acid transporter; Neutral amino acid transporter A; OTTHUMP00000159933; OTTHUMP00000235138; SATT; SATT_HUMAN; SLC1A4; Solute carrier family 1 (glutamate/neutral amino acid transporter). member 4; Solute carrier family 1 member 4
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P43007
-
Expression Region
140-216 aa
-
AA Sequence
KPGSGAQTLQSSDLGLEDSGPPPVPKETVDSFLDLARNLFPSNLVVAAFRTYATDYKVVTQNSSSGNVTHEKIPIGT
-
Molecular Weight
34.21 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC1A4, a member of the solute carrier family, encodes a sodium-dependent neutral amino acid transporter predominantly expressed in the brain and other tissues. This transporter plays a crucial role in regulating glutamate and aspartate levels, thus influencing neurotransmission and neurodevelopment. Abnormal SLC1A4 function has been implicated in various neurological disorders, including schizophrenia, autism spectrum disorders, and other mental health conditions. Recent research has focused on the structural and functional characterization of SLC1A4 to better understand its role in amino acid transport and neurotransmitter cycling. The production of recombinant SLC1A4 proteins has become essential for investigating its biophysical properties, transport mechanisms, and interactions with other cellular components. By employing techniques such as site-directed mutagenesis, crystallography, and functional assays, researchers aim to elucidate the transport dynamics of SLC1A4, providing insights into how its dysfunction contributes to pathological states. Such studies not only enhance our understanding of the basic neuroscience underlying amino acid transport but also pave the way for potential therapeutic strategies targeting SLC1A4-related disorders. Consequently, the exploration of SLC1A4 as a biomarker or therapeutic target has gained increasing attention in recent years, reflecting its significance in both basic research and clinical applications.
