Cat: IPD-X50256

Recombinant Human MZF1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MZF1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Myeloid zinc finger 1; MZF 1; MZF-1; MZF1; MZF1_HUMAN; MZF1B; Zfp98; Zinc finger and SCAN domain containing protein 6 ; Zinc finger and SCAN domain-containing protein 6; Zinc finger protein 42; ZNF42; ZSCAN6

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P28698

  • Expression Region

    37-128aa

  • AA Sequence

    DPGPEAARLRFRCFRYEEATGPQEALAQLRELCRQWLRPEVRSKEQMLELLVLEQFLGALPPEIQARVQGQRPGSPEEAAALVDGLRREPGG

  • Molecular Weight

    11kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The MZF1 (Myeloid Zinc Finger 1) protein is a crucial transcription factor that plays a significant role in the regulation of gene expression during myeloid development and cellular differentiation. Recent studies have highlighted its involvement in various biological processes, including hematopoiesis, immune response, and tumorigenesis. MZF1 is characterized by its zinc finger domains, which facilitate DNA binding and interaction with other proteins, thereby influencing target gene activation or repression. Alterations in MZF1 expression levels have been implicated in several hematological malignancies and other diseases, making it a potential biomarker for diagnosis and therapeutic targets. Research focusing on the recombinant expression of MZF1 aims to elucidate its functional properties, regulatory mechanisms, and interaction network within the cell. By producing and characterizing recombinant MZF1, researchers can investigate its structural features, stability, and binding affinity to specific DNA sequences, enriching our understanding of its role in health and disease. Additionally, recombinant MZF1 can be utilized in high-throughput screening assays to identify novel inhibitors or modulators of its activity, paving the way for potential therapeutic interventions. Overall, the study of recombinant MZF1 protein not only enhances our comprehension of myeloid lineage differentiation and immune function but also opens new avenues for targeted therapies in cancers and other disorders related to dysregulated transcriptional programs.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US