Cat: PAX2000-11345

Recombinant Human SLC13A5 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SLC13A5

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Na(+)/citrate cotransporter; NaC2/NaCT; NaCT; Novel solute carrier family 13 (sodium dependent dicarboxylate transporter) (Slc13a2 or 3) member; S13A5_HUMAN; Slc13a5; Sodium coupled citrate transporter; Sodium-coupled citrate transporter; Sodium-dependent citrate transporter; Solute carrier family 13 (sodium dependent citrate transporter); member 5; Solute carrier family 13 member 5

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q86YT5

  • Expression Region

    152-206 aa

  • AA Sequence

    VEAILQQMEATSAATEAGLELVDKGKAKELPGSQVIFEGPTLGQQEDQERKRLCK

  • Molecular Weight

    31.79 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SLC13A5 is a member of the SLC (solute carrier) family of transporters, primarily known for its role in sodium-dependent citrate transport. Its significance has been underscored by its association with metabolic disorders, particularly its involvement in the regulation of cellular metabolism and energy homeostasis. Mutations in the SLC13A5 gene have been linked to a rare form of epilepsy known as early infantile epileptic encephalopathy (EIEE25), highlighting the protein's crucial role in neurological function. The study of recombinant SLC13A5 protein is essential for understanding its structure-function relationship and facilitating the development of therapeutic strategies for associated conditions. By producing this protein in a recombinant system, researchers can explore its transport mechanisms, interactions with other cellular components, and the impact of specific mutations on its function. Additionally, characterizing SLC13A5 at the molecular level can lead to insights into its regulatory pathways, which may reveal novel targets for pharmacological intervention. Overall, the investigation of SLC13A5 recombinant protein plays a pivotal role in elucidating its biological functions and potential as a target for treating metabolic and neurological disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US