Analytical Data
-
Gene name
VASH2
- Application
-
Alternative Names
VASH2；VASHL；Tubulinyl-Tyr carboxypeptidase 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86V25
-
Expression Region
1-355aa
-
AA Sequence
MTGSAADTHRCPHPKGAKGTRSRSSHARPVSLATSGGSEEEDKDGGVLFHVNKSGFPIDSHTWERMWMHVAKVHPKGGEMVGAIRNAAFLAKPSIPQVPNYRLSMTIPDWLQAIQNYMKTLQYNHTGTQFFEIRKMRPLSGLMETAKEMTRESLPIKCLEAVILGIYLTNGQPSIERFPISFKTYFSGNYFHHVVLGIYCNGRYGSLGMSRRAELMDKPLTFRTLSDLIFDFEDSYKKYLHTVKKVKIGLYVPHEPHSFQPIEWKQLVLNVSKMLRADIRKELEKYARDMRMKILKPASAHSPTQVRSRGKSLSPRRRQASPPRRLGRREKSPALPEKKVADLSTLNEVGYQIRI
-
Molecular Weight
56.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
VASH2 (Vasohibin-2) is a member of the vasohibin family, which plays a crucial role in angiogenesis and vascular biology. It was initially identified due to its ability to inhibit endothelial cell migration and tube formation, functions vital for new blood vessel development in various physiological and pathological processes. VASH2 is believed to mediate its effects through interaction with various signaling pathways, thus influencing cell proliferation and survival. Research has shown that VASH2 is upregulated in conditions associated with increased angiogenesis, such as cancer, cardiovascular diseases, and wound healing. The study of VASH2 and its recombinant protein form has become increasingly important for therapeutic purposes, as understanding its mechanism of action can lead to novel strategies for angiogenesis modulation. Furthermore, recombinant VASH2 protein is being explored for its potential applications in drug development, including anticancer therapies and treatments for ischemic diseases. By elucidating the structure-function relationship of VASH2 recombinants, researchers aim to harness its anti-angiogenic properties, making it a promising candidate in the field of targeted therapies. Overall, the characterization and functional analysis of VASH2 recombinant protein represent a significant frontier in vascular research, with implications for clinical applications in managing diseases characterized by abnormal blood vessel formation.
