Cat: PA1000-7611

Recombinant Human LILRA3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    LILRA3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    LILRA3;ILT6;LIR4;Leukocyte immunoglobulin-like receptor subfamily A member 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8N6C8

  • Expression Region

    19-439aa

  • AA Sequence

    THVQAGPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTAL WITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTVGLSESSDPLELVV TGAYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCL NSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLL VPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQR PGRQPQAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILI TGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLR LKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELV VSGAAETLSPPQNKSDSKAGEVDHHHHHH

  • Molecular Weight

    47 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

LILRA3 (Leukocyte Immunoglobulin Like Receptor A3) is a member of the leukocyte immunoglobulin-like receptor (LILR) family, known for its role in modulating immune responses. This receptor is predominantly expressed on immune cells such as monocytes, dendritic cells, and macrophages. LILRA3 has garnered attention due to its unique ability to inhibit pro-inflammatory activities, making it a crucial player in maintaining immune homeostasis and preventing excessive inflammation. Research indicates that dysregulation of LILRA3 is associated with various autoimmune diseases and inflammatory conditions, prompting investigations into its therapeutic potential. Recombinant LILRA3 proteins are being developed to study their functional roles and interactions with other immune components, as well as to explore their use as biomarkers for disease progression. Understanding LILRA3's signaling pathways and mechanisms of action could provide insights into novel immunotherapies, highlighting its significance in both immunology and potential clinical applications. This research aims to illuminate the intricacies of immune regulation and pave the way for innovative approaches in treating immune-related disorders, positioning LILRA3 as a focal point in contemporary immunological studies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US