Analytical Data
-
Gene name
SELS
- Application
-
Alternative Names
Selenoprotein S. SelS. VCP-interacting membrane protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BQE4
-
Expression Region
1-189 aa
-
AA Sequence
MERQEESLSARPALETEGLRFLHTTVGSLLATYGWYIVFSCILLYVVFQKLSARLRALRQRQLDRAAAAVEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEVWDSMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGRRGPSSGG
-
Molecular Weight
46.53 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of SELS (selenoprotein S) recombinant protein is rooted in the growing interest in the role of selenoproteins in human health and disease. Selenoprotein S is a newly identified member of the selenoprotein family, which utilizes selenium, an essential trace element, for its biological functions. SELS is known to be implicated in various cellular processes, including oxidative stress response, inflammation, and insulin signaling. As research continues to unveil the significance of selenium in mitigating oxidative damage and its potential protective effects against chronic diseases, such as diabetes and neurodegenerative disorders, the study of SELS becomes increasingly relevant. Recombinant technology enables the production of SELS in large quantities, facilitating detailed biochemical characterization and functional studies. Investigating SELS's structure and function can provide valuable insights into its mechanisms of action and therapeutic potential. Furthermore, understanding SELS may pave the way for novel selenoprotein-based interventions that harness the beneficial effects of selenium on health. Therefore, the research on recombinant SELS not only enhances our comprehension of selenoprotein biology but also holds promise for developing targeted strategies to improve health outcomes associated with selenium deficiency and related disorders.
