Analytical Data
-
Gene name
SELK
- Application
-
Alternative Names
Selenoprotein K. SelK
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y6D0
-
Expression Region
1-91 aa
-
AA Sequence
MVYISNGQVLDSRSQSPWRLSLITDFFWGIAEFVVLFFKTLLQQDVKKRRSYGNSSDSRYDDGRGPPGNPPRRMGRINHLRGPSPPPMAGG
-
Molecular Weight
36.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SELK (Sarcoplasmic Reticulum Ca2+ ATPase-Linked K+ channel) is a critical protein involved in cellular processes such as muscle contraction, neurotransmitter release, and maintaining cellular ion homeostasis. As a member of the ion channel family, SELK plays a pivotal role in regulating potassium ion flow across cell membranes, which is essential for various physiological functions. Recent research has highlighted the importance of SELK in pathophysiological conditions, including cardiac and neurological disorders. Studies have shown that alterations in SELK expression or function can significantly impact cellular excitability and signaling pathways, leading to disease phenomena. Consequently, understanding the molecular structure and functional mechanisms of SELK has become a focal point in membrane biophysics and pharmacology. Researchers are exploring the potential of SELK as a therapeutic target for diseases characterized by ion channel dysregulation. In the laboratory, SELK is typically studied through various biochemical and biophysical techniques, including crystallography and electrophysiology, to elucidate its role in health and disease. The ongoing investigation into SELK's structure and function not only contributes to the fundamental understanding of ion channel biology but also opens pathways for developing novel therapeutic strategies aimed at restoring normal cellular function in affected conditions. As this research progresses, it promises to provide deeper insights into the intricate balance of ion homeostasis in living organisms and offers a potential avenue for innovative treatments in the realm of personalized medicine.
