Cat: PA2000-3067

Recombinant Human HESRG Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HESRG

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    HESRG;HESRG;Embryonic stem cell-related gene Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q1W209

  • Expression Region

    1-222aa

  • AA Sequence

    MTLFSDSARLHPGEINSLVAHTKPVWWSLHTDAHEIWCRDSDRGTSLGRSIPCPPALCSVRKIHLRPQVLRPTSPRNISPISNPVSGLFLLCSPTSLTIPQPLSPFNLGATLQSLPSLNFNSFHSLVETKETCFIREPKTPAPVTDWEGSLPLVFNHCRDASLISRFRPRRDACLGPSPLAASPAFLGQGQVPLNPFSFTLSGKSRFSGAGASTPQPLLLHP

  • Molecular Weight

    28.2 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HESRG (Harnessed Embryonic Stem Cell Regulation Gene) is a recently identified protein implicated in the regulation of embryonic stem cell differentiation and pluripotency. The study of HESRG has gained significant attention due to its potential role in stem cell biology and regenerative medicine. Its expression is predominantly observed in embryonic stem cells and during early developmental stages, suggesting that it may be critical for maintaining the undifferentiated state of these cells. Additionally, HESRG has been linked to various signaling pathways that govern cellular fate and could offer insights into the mechanisms underlying tissue regeneration and repair. Advances in gene editing technologies, such as CRISPR-Cas9, have made it feasible to explore the functional roles of HESRG in greater detail, providing opportunities to investigate its interactions with other regulatory networks. Understanding the molecular functions of HESRG can potentially lead to innovative strategies for manipulating stem cell behavior, which is essential for developing therapies for degenerative diseases and injuries. Furthermore, the implications of HESRG in disease contexts, including cancer, highlight its significance in both fundamental biology and clinical applications. Consequently, research into HESRG not only enriches the knowledge of stem cell dynamics but also opens avenues for novel therapeutic developments, emphasizing the importance of this protein in the intersection of developmental biology and medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US