Analytical Data
-
Gene name
HESRG
- Application
-
Alternative Names
HESRG；HESRG；Embryonic stem cell-related gene Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q1W209
-
Expression Region
1-222aa
-
AA Sequence
MTLFSDSARLHPGEINSLVAHTKPVWWSLHTDAHEIWCRDSDRGTSLGRSIPCPPALCSVRKIHLRPQVLRPTSPRNISPISNPVSGLFLLCSPTSLTIPQPLSPFNLGATLQSLPSLNFNSFHSLVETKETCFIREPKTPAPVTDWEGSLPLVFNHCRDASLISRFRPRRDACLGPSPLAASPAFLGQGQVPLNPFSFTLSGKSRFSGAGASTPQPLLLHP
-
Molecular Weight
28.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HESRG (Harnessed Embryonic Stem Cell Regulation Gene) is a recently identified protein implicated in the regulation of embryonic stem cell differentiation and pluripotency. The study of HESRG has gained significant attention due to its potential role in stem cell biology and regenerative medicine. Its expression is predominantly observed in embryonic stem cells and during early developmental stages, suggesting that it may be critical for maintaining the undifferentiated state of these cells. Additionally, HESRG has been linked to various signaling pathways that govern cellular fate and could offer insights into the mechanisms underlying tissue regeneration and repair. Advances in gene editing technologies, such as CRISPR-Cas9, have made it feasible to explore the functional roles of HESRG in greater detail, providing opportunities to investigate its interactions with other regulatory networks. Understanding the molecular functions of HESRG can potentially lead to innovative strategies for manipulating stem cell behavior, which is essential for developing therapies for degenerative diseases and injuries. Furthermore, the implications of HESRG in disease contexts, including cancer, highlight its significance in both fundamental biology and clinical applications. Consequently, research into HESRG not only enriches the knowledge of stem cell dynamics but also opens avenues for novel therapeutic developments, emphasizing the importance of this protein in the intersection of developmental biology and medicine.
