Cat: PAX2000-11161

Recombinant Human SCN8A Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SCN8A

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CerIII; CIAT; EIEE13; hNa6/Scn8a voltage gated sodium channel; MED; Motor endplate disease; NaCh 6; NaCh6; Nav 1.6; Nbna1; peripheral nerve protein type 4; PN 4; PN4; SCN8A; SCN8A_HUMAN; Sodium channel protein type 8 alpha subunit; Sodium channel protein type 8 subunit alpha; Sodium channel protein type VIII alpha subunit; Sodium channel protein type VIII subunit alpha; Sodium channel voltage gated type VIII alpha; Sodium channel voltage gated type VIII alpha polypeptide; Sodium channel voltage gated type VIII alpha subunit; Voltage gated sodium channel subunit alpha Nav1.6; Voltage-gated sodium channel subunit alpha Nav1.6

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UQD0

  • Expression Region

    1854-1951  aa

  • AA Sequence

    RVLGDSGELDILRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYRGHLARRGFICKKTTSNKLENGGTHREKKESTPSTASLPSYDSVT

  • Molecular Weight

    36.52 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SCN8A, a gene encoding a voltage-gated sodium channel (NaV1.6), plays a critical role in the generation and propagation of action potentials in neurons. Mutations in SCN8A have been linked to various neurological disorders, including epilepsy, developmental delay, and movement disorders, highlighting its significance in neuronal excitability and function. The study of SCN8A recombinant protein is crucial for understanding the molecular mechanisms underlying these disorders. Researchers aim to elucidate how specific mutations affect channel properties like ion permeability, gating kinetics, and pharmacological responses. By expressing and purifying the SCN8A protein, scientists can employ biochemical and electrophysiological techniques to investigate its functional characteristics. This research not only provides insights into the pathophysiology of SCN8A-related diseases but also aids in the development of targeted therapies. Understanding the structure-function relationship of SCN8A may lead to novel treatment strategies for patients suffering from SCN8A-related disorders, emphasizing the importance of detailed studies on its recombinant protein.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US