Analytical Data
-
Gene name
SCN8A
- Application
-
Alternative Names
CerIII; CIAT; EIEE13; hNa6/Scn8a voltage gated sodium channel; MED; Motor endplate disease; NaCh 6; NaCh6; Nav 1.6; Nbna1; peripheral nerve protein type 4; PN 4; PN4; SCN8A; SCN8A_HUMAN; Sodium channel protein type 8 alpha subunit; Sodium channel protein type 8 subunit alpha; Sodium channel protein type VIII alpha subunit; Sodium channel protein type VIII subunit alpha; Sodium channel voltage gated type VIII alpha; Sodium channel voltage gated type VIII alpha polypeptide; Sodium channel voltage gated type VIII alpha subunit; Voltage gated sodium channel subunit alpha Nav1.6; Voltage-gated sodium channel subunit alpha Nav1.6
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UQD0
-
Expression Region
1854-1951 aa
-
AA Sequence
RVLGDSGELDILRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYRGHLARRGFICKKTTSNKLENGGTHREKKESTPSTASLPSYDSVT
-
Molecular Weight
36.52 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SCN8A, a gene encoding a voltage-gated sodium channel (NaV1.6), plays a critical role in the generation and propagation of action potentials in neurons. Mutations in SCN8A have been linked to various neurological disorders, including epilepsy, developmental delay, and movement disorders, highlighting its significance in neuronal excitability and function. The study of SCN8A recombinant protein is crucial for understanding the molecular mechanisms underlying these disorders. Researchers aim to elucidate how specific mutations affect channel properties like ion permeability, gating kinetics, and pharmacological responses. By expressing and purifying the SCN8A protein, scientists can employ biochemical and electrophysiological techniques to investigate its functional characteristics. This research not only provides insights into the pathophysiology of SCN8A-related diseases but also aids in the development of targeted therapies. Understanding the structure-function relationship of SCN8A may lead to novel treatment strategies for patients suffering from SCN8A-related disorders, emphasizing the importance of detailed studies on its recombinant protein.
