Analytical Data
-
Gene name
DUSP3
- Application
-
Alternative Names
DUSP3；VHR；Dual specificity Protein phosphatase 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P51452
-
Expression Region
1-205aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMSGSFELSVQDLNDLLSDGSGCYSLPSQPC NEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHNTNANFYKDS GITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRS PTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEG KLKP
-
Molecular Weight
23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DUSP3, or Dual Specificity Protein Phosphatase 3, is a member of the dual specificity phosphatase family, which plays a critical role in the regulation of various cellular processes, including cell growth, differentiation, and response to stress signals. This protein dephosphorylates both tyrosine and serine/threonine residues in target proteins, thus impacting several key signaling pathways such as MAPK (Mitogen-Activated Protein Kinase) pathways. Research has indicated that DUSP3 may have implications in cancer biology, as its expression levels are often altered in various tumors, suggesting a potential role in tumor progression and response to treatment. Additionally, DUSP3 has been linked to inflammatory responses and immune functions, further highlighting its importance in disease contexts. Given its regulatory functions, DUSP3 is a promising target for therapeutic intervention. Understanding the structure and function of DUSP3 through recombinant protein studies can provide valuable insights into its biological roles and the mechanisms underlying its dysregulation in diseases. Such research may pave the way for novel approaches in the development of targeted therapies, ultimately contributing to advancements in personalized medicine strategies.
