Cat: PA1000-6556

Recombinant Human DUSP3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DUSP3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DUSP3;VHR;Dual specificity Protein phosphatase 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P51452

  • Expression Region

    1-205aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMSGSFELSVQDLNDLLSDGSGCYSLPSQPC NEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHNTNANFYKDS GITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRS PTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEG KLKP

  • Molecular Weight

    23 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DUSP3, or Dual Specificity Protein Phosphatase 3, is a member of the dual specificity phosphatase family, which plays a critical role in the regulation of various cellular processes, including cell growth, differentiation, and response to stress signals. This protein dephosphorylates both tyrosine and serine/threonine residues in target proteins, thus impacting several key signaling pathways such as MAPK (Mitogen-Activated Protein Kinase) pathways. Research has indicated that DUSP3 may have implications in cancer biology, as its expression levels are often altered in various tumors, suggesting a potential role in tumor progression and response to treatment. Additionally, DUSP3 has been linked to inflammatory responses and immune functions, further highlighting its importance in disease contexts. Given its regulatory functions, DUSP3 is a promising target for therapeutic intervention. Understanding the structure and function of DUSP3 through recombinant protein studies can provide valuable insights into its biological roles and the mechanisms underlying its dysregulation in diseases. Such research may pave the way for novel approaches in the development of targeted therapies, ultimately contributing to advancements in personalized medicine strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US