Analytical Data
-
Gene name
C18orf55
- Application
-
Alternative Names
TIMM21; C18orf55; TIM21; HSPC154; Mitochondrial import inner membrane translocase subunit Tim21; TIM21-like Protein; mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BVV7
-
Expression Region
1-248aa
-
AA Sequence
MICTFLRAVQYTEKLHRSSAKRLLLPYIVLNKACLKTEPSLRCGLQYQKKTLRPRCILGVTQKTIWTQGPSPRKAKEDGSKQVSVHRSQRGGTAVPTSQKVKEAGRDFTYLIVVLFGISITGGLFYTIFKELFSSSSPSKIYGRALEKCRSHPEVIGVFGESVKGYGEVTRRGRRQHVRFTEYVKDGLKHTCVKFYIEGSEPGKQGTVYAQVKENPGSGEYDFRYIFVEIESYPRRTIIIEDNRSQDD
-
Molecular Weight
55.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C18orf55, also known as "Chromosome 18 open reading frame 55," is a relatively less-characterized protein that has garnered interest in various fields of biomedical research. Located on chromosome 18, this gene encodes a protein that appears to be involved in critical cellular processes, although its exact functions remain largely unexplored. Recent studies have suggested potential roles for C18orf55 in cellular signaling, metabolism, and even in the pathology of certain diseases. Notably, its expression patterns have been linked to specific tissues and developmental stages, indicating a potential role in differentiation and growth regulation. The study of C18orf55 recombinant proteins has been crucial for understanding the structural and functional properties of this protein. By expressing C18orf55 in heterologous systems, researchers can analyze its interactions with other biomolecules, investigate its enzymatic activities, and elucidate its possible involvement in disease mechanisms. Given the paucity of information about C18orf55, this research may offer new insights into its biological significance and potential therapeutic implications in conditions where its expression is altered. The ongoing exploration of C18orf55 is essential for providing a comprehensive understanding of its role in cellular homeostasis and disease, paving the way for future studies aimed at targeting this protein for therapeutic strategies.











