Analytical Data
-
Gene name
C18orf43
- Application
-
Alternative Names
PRELID3A; C18orf43; SLMO1; PRELI domain containing Protein 3A; Protein slowmo homolog 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96N28
-
Expression Region
1-57aa
-
AA Sequence
MRGEGWGPGVSRPFLQAVPAPSSLPLPCPGDILRPGWRPCLAACQPHLLGLEAMDPS
-
Molecular Weight
31.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C18orf43, also known as C18orf43 protein or CHMP4B-like protein, is a gene located on chromosome 18 that has garnered interest due to its potential roles in cellular processes such as endosomal sorting and membrane trafficking. While its exact biological function remains largely uncharacterized, preliminary studies suggest that C18orf43 may be involved in the regulation of autophagy and intracellular signaling pathways. Research has shown that alterations in genes like C18orf43 can be implicated in various diseases, including neurodegenerative disorders and certain types of cancer. Therefore, the recombinant expression of C18orf43 protein is essential for elucidating its functional roles and potential applications in therapeutic contexts. By producing this protein through recombinant DNA technology, researchers aim to study its molecular interactions, structural characteristics, and physiological implications. Understanding C18orf43's mechanisms may provide insights into its contributions to disease pathogenesis and identify new targets for drug development. Thus, the investigation of C18orf43 recombinant protein holds promise for advancing our knowledge in cellular biology and developing novel therapeutic strategies.
