Cat: PA2000-6060

Recombinant Human C18orf43 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    C18orf43

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PRELID3A; C18orf43; SLMO1; PRELI domain containing Protein 3A; Protein slowmo homolog 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96N28

  • Expression Region

    1-57aa

  • AA Sequence

    MRGEGWGPGVSRPFLQAVPAPSSLPLPCPGDILRPGWRPCLAACQPHLLGLEAMDPS

  • Molecular Weight

    31.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

C18orf43, also known as C18orf43 protein or CHMP4B-like protein, is a gene located on chromosome 18 that has garnered interest due to its potential roles in cellular processes such as endosomal sorting and membrane trafficking. While its exact biological function remains largely uncharacterized, preliminary studies suggest that C18orf43 may be involved in the regulation of autophagy and intracellular signaling pathways. Research has shown that alterations in genes like C18orf43 can be implicated in various diseases, including neurodegenerative disorders and certain types of cancer. Therefore, the recombinant expression of C18orf43 protein is essential for elucidating its functional roles and potential applications in therapeutic contexts. By producing this protein through recombinant DNA technology, researchers aim to study its molecular interactions, structural characteristics, and physiological implications. Understanding C18orf43's mechanisms may provide insights into its contributions to disease pathogenesis and identify new targets for drug development. Thus, the investigation of C18orf43 recombinant protein holds promise for advancing our knowledge in cellular biology and developing novel therapeutic strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US