Analytical Data
-
Gene name
IL22R
- Application
-
Alternative Names
IL22R；IL22R；Interleukin-22 receptor subunit alpha-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N6P7
-
Expression Region
250-573aa
-
AA Sequence
SYRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQYSQIRVSGPREPAGAPQRHSLSEITYLGQPDISILQPSNVPPPQILSPLSYAPNAAPEVGPPSYAPQVTPEAQFPFYAPQAISKVQPSSYAPQATPDSWPPSYGVCMEGSGKDSPTGTLSSPKHLRPKGQLQKEPPAGSCMLGGLSLQEVTSLAMEESQEAKSLHQPLGICTDRTSDPNVLHSGEEGTPQYLKGQLPLLSSVQIEGHPMSLPLQPPSRPCSPSDQGPSPWGLLESLVCPKDEAKSPAPETSDLEQPTELDSLFRGLALTVQWE
-
Molecular Weight
50.8kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The IL-22 receptor (IL-22R) is a crucial component of the immune system, primarily playing a significant role in the regulation of inflammatory responses and tissue homeostasis. IL-22, a cytokine produced by various immune cells, interacts with IL-22R, which is primarily expressed in non-hematopoietic tissues, such as epithelial cells. The IL-22/IL-22R signaling pathway has been implicated in several pathological conditions, including autoimmune diseases, infections, and cancer. Research has revealed that the activation of IL-22R can promote tissue repair and regeneration, particularly in epithelial tissues, suggesting its potential therapeutic roles in managing inflammatory and degenerative diseases. Furthermore, the exploration of IL-22R as a target for novel therapeutics has gained traction, especially in understanding its mechanism of action and the downstream signaling pathways involved. Recombinant proteins of IL-22R have been developed to study its binding affinity, receptor activation, and downstream effects in various biological contexts. These recombinant proteins serve as essential tools for elucidating the role of IL-22R in health and disease, advancing our understanding of immune regulation and offering insights for potential clinical applications in immunotherapy and regenerative medicine. Researchers are increasingly focused on characterizing these recombinant proteins to enhance their efficacy and specificity, thereby contributing to the development of targeted therapies that could manipulate the IL-22 pathway for beneficial outcomes in patients suffering from chronic inflammatory conditions.
