Cat: PA1000-4963

Recombinant Human KLK4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    KLK4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    KLK4;EMSP1;PRSS17;PSTS;Kallikrein-4

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9Y5K2

  • Expression Region

    27-254aa

  • AA Sequence

    SCSQIINGEDCSPHSQPWQAALVMENELFCSGVLVHPQWVLSAAHCFQNS YTIGLGLHSL EADQEPGSQMVEASLSVRHPEYNRPLLANDLMLIKLDESVSESDTIRSIS IASQCPTAGN SCLVSGWGLLANGRMPTVLQCVNVSVVSEEVCSKLYDPLYHPSMFCAGGG QDQKDSCNGD SGGPLICNGYLQGLVSFGKAPCGQVGVPGVYTNLCKFTEWIEKTVQASVD HHHHHH

  • Molecular Weight

    25 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

KLK4, or Kallikrein-related peptidase 4, is a member of the kallikrein family of serine proteases, which play essential roles in various physiological and pathological processes, including tissue remodeling, inflammation, and cancer progression. Research has shown that KLK4 is upregulated in prostate cancer, making it a potential biomarker for diagnosis and a target for therapeutic intervention. The study of KLK4 recombinant proteins has gained interest due to their potential applications in understanding the enzyme's biological functions and its involvement in disease mechanisms. By producing KLK4 in a recombinant form, researchers can investigate its enzymatic activity, substrate specificity, and interactions with other biomolecules in a controlled environment. This approach facilitates the exploration of KLK4's role in cancer metastasis and its potential utility in clinical settings, such as the development of novel diagnostic tools or targeted therapies. Moreover, understanding the structure-function relationship of KLK4 through recombinant protein studies can provide insights into its regulatory mechanisms and the development of inhibitors that could mitigate its pathological effects. Overall, the investigation of KLK4 recombinant proteins represents a promising avenue for advancing our knowledge of this enzyme and its implications in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US