Analytical Data
-
Gene name
MT2A
- Application
-
Alternative Names
MT2A；CES1；MT2；Metallothionein-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P02795
-
Expression Region
1-59aa
-
AA Sequence
MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSC
-
Molecular Weight
7.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MT2A (Metallothionein 2A) is a low-molecular-weight, cysteine-rich protein that plays a crucial role in metal ion homeostasis, detoxification, and cellular protection against oxidative stress. The MT2A gene is part of a larger metallothionein family that responds to various physiological and pathological stimuli, including heavy metal exposure, inflammation, and cellular stress. Research has shown that MT2A is implicated in numerous biological processes, such as cell proliferation, apoptosis, and differentiation. Its expression is tightly regulated and varies across different tissues and developmental stages, highlighting its significance in both normal physiology and disease contexts. Studies have linked altered MT2A expression to various health conditions, including cancer, neurodegenerative disorders, and cardiovascular diseases, suggesting that it may serve as a potential biomarker or therapeutic target. Given its multifunctional roles, recombinant MT2A protein has garnered attention for studying its specific functions in cellular mechanisms, understanding metal toxicity, and exploring its potential in biomedicine. The development of MT2A recombinant protein allows researchers to investigate its structural properties, binding affinities to metal ions, and interactions with other cellular proteins, thereby providing insights into its role in maintaining metal homeostasis and protecting cells from oxidative damage. As the field continues to explore the therapeutic implications of MT2A, understanding its molecular dynamics and regulatory pathways will be critical for advancing treatment strategies for metal-related disorders and promoting cellular health.
