Analytical Data
-
Gene name
MT4
- Application
-
Alternative Names
MT4；Metallothionein-4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P47944
-
Expression Region
1-62aa
-
AA Sequence
MDPRECVCMSGGICMCGDNCKCTTCNCKTYWKSCCPCCPPGCAKCARGCICKGGSDKCSCCP
-
Molecular Weight
22.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MT4, or metallothionein 4, is a low-molecular-weight, cysteine-rich protein that plays a significant role in metal ion homeostasis and cellular stress responses. Initially identified in the context of heavy metal detoxification, MT4 has recently attracted attention for its potential roles in various physiological processes and pathologies, including neurodegenerative diseases and cancer. Research has shown that MT4 may participate in antioxidant defense, modulation of inflammation, and regulation of cell proliferation and apoptosis. Its expression is often tissue-specific, suggesting a tailored physiological function that is still not fully understood. The study of MT4 has been bolstered by advances in proteomics and molecular biology, which have facilitated the exploration of its structure, interaction with metals, and post-translational modifications. Additionally, the potential therapeutic applications of MT4 and its derivatives in clinical settings are currently being investigated, highlighting its importance in biomedical research and the need for further studies to elucidate its full biological significance.
