Analytical Data
-
Gene name
APOA2
- Application
-
Alternative Names
APOA2；ApolipoProtein A-II
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P02652
-
Expression Region
24-100aa
-
AA Sequence
QAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ
-
Molecular Weight
21.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Apolipoprotein A2 (APOA2) is a critical component of high-density lipoprotein (HDL) that plays a significant role in lipid metabolism and cardiovascular health. Research has increasingly focused on the genetic and biochemical properties of APOA2 due to its association with plasma lipid levels and its potential implications in atherosclerosis and other cardiovascular diseases. Variations in the APOA2 gene have been linked to differences in HDL concentration and composition, while its lipid-binding capacity contributes to reverse cholesterol transport, a vital process in maintaining cellular cholesterol homeostasis. The recombinant expression of APOA2 allows for the detailed study of its functional properties, including its interaction with lipids and other apolipoproteins. By producing recombinant APOA2, researchers can investigate its structural biology, elucidate its role in HDL metabolism, and assess how its variations affect lipid profiles in various populations. This research has significant implications for understanding the genetic determinants of cardiovascular risk and developing targeted therapies for lipid-related disorders. Furthermore, the study of recombinant APOA2 serves as a basis for potential therapeutic applications, such as gene therapy or developing HDL-mimetic therapies aimed at enhancing cardiovascular health. Overall, the exploration of APOA2 through recombinant protein technology is vital for advancing our understanding of lipid metabolism and its impact on cardiovascular disease.
