Analytical Data
-
Gene name
MT1X
- Application
-
Alternative Names
MT1X;Metallothionein-1X
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P80297
-
Expression Region
1-59aa
-
AA Sequence
MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSC
-
Molecular Weight
32.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MT1X, a member of the metallothionein family, plays a crucial role in cellular metal ion homeostasis and detoxification processes. The interest in studying MT1X has grown due to its potential implications in various physiological and pathological conditions, including cancer, neurodegenerative diseases, and metal poisoning. Metallothioneins are small, cysteine-rich proteins that can bind heavy metals, thereby mitigating their toxic effects and participating in antioxidant defense. Researchers have been particularly focused on understanding the structure-function relationships of MT1X to elucidate its mechanisms of action. Recent studies highlight its involvement in the regulation of zinc and copper ions, which are vital for numerous biological processes. Additionally, MT1X has been linked to cellular stress responses, making it a candidate for therapeutic interventions. The recombinant expression of MT1X has enabled detailed biochemical analyses, facilitating the examination of its interactions with metal ions and other biomolecules. Understanding the functional capacities of MT1X can pave the way for novel applications in biomedical research, particularly in developing strategies for managing diseases associated with metal imbalances. Given its extensive post-translational modifications and adaptive responses to environmental changes, further investigation into MT1X could reveal critical insights into cellular metal homeostasis and its broader implications in health and disease.











